PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10027470m
Common NameEUTSA_v10027470mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family M-type_MADS
Protein Properties Length: 81aa    MW: 9498.33 Da    PI: 10.555
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10027470mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.37.1e-22957149
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     k+ie+k +r++ f+kR+ g+lKKA+EL +LCd+++a++ fs++gkl+ +
  Thhalv10027470m  9 KKIEDKQQRNIAFAKRKSGLLKKAYELYILCDVQIALVFFSPSGKLFLF 57
                     78********************************************877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.862161IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-26160IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.42E-26276IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-22323IPR002100Transcription factor, MADS-box
PfamPF003193.9E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-222338IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-223859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MGRVKIQMKK IEDKQQRNIA FAKRKSGLLK KAYELYILCD VQIALVFFSP SGKLFLFDSK  60
TRIEETIHKY LELPCYRRGR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A7e-18272170Myocyte-specific enhancer factor 2A
3kov_B7e-18272170Myocyte-specific enhancer factor 2A
3kov_I7e-18272170Myocyte-specific enhancer factor 2A
3kov_J7e-18272170Myocyte-specific enhancer factor 2A
3p57_A7e-18272170Myocyte-specific enhancer factor 2A
3p57_B7e-18272170Myocyte-specific enhancer factor 2A
3p57_C7e-18272170Myocyte-specific enhancer factor 2A
3p57_D7e-18272170Myocyte-specific enhancer factor 2A
3p57_I7e-18272170Myocyte-specific enhancer factor 2A
3p57_J7e-18272170Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411890.15e-53hypothetical protein EUTSA_v10027470mg
SwissprotQ9LM461e-25AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBLV4MKU55e-53V4MKU5_EUTSA; Uncharacterized protein
STRINGBra011763.1-P5e-38(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.16e-27AGAMOUS-like 104